#fluseason feeds

Top feeds

Horrific cold has consumed my Fri-Yay and this cutie can’t be more concerned. Noble is so intuitive to my feelings it’s unbelievable at times. He knows just what I need and when I need him. Right now he’s curing me with all the best cuddles. #drnobleatyourservice #blessedwiththebest

1.83k

45

Flu season tip from your favorite insta-niece! 😩😂 #maddiecakes #simplymadisonjade #fluseason #germs #prayaboutit #explore #instaadorable #tipoftheday #kindergartentips #kindergarten

39.57k

1.17k

I slept for 10 hours last night... 😷😴🤒 // When you’re sick, are you the “tough it out” type? Or the “someone plz take care of meeeeee” type? I think I’m the latter 😓😬 #fluseason #coldseason

739

10

As I lay here on my couch with the plague, I figured I would post a picture from a time I felt happy, healthy and alive. . Funny thing is, I told a friend the other day I NEVER get sick. #jinxedmyself 🤒 . Seeing as it’s Day 3, I am hoping to to be well enough to return to my normal daily activities tomorrow which include, leaving the house (who would of guessed?), getting a workout in and visiting clients. . In the meantime I am catching up on the 3 years of television I have missed. For those who don’t know, I rarely watch tv at home. In the last 6 months I can count on one hand how many times I turned my television on.😱 . THAT SAID - Send me some tv series recommendations and movies. Nothing too thought provoking please lol. 👇🏼👇🏼 #fluseason #sickinbed #houston

561

58

Its Flu season!!!! 🤣🤣🤣🤣 what name should I called this monster? #zbrush #substancepainter #maya #redshift3d #blender3d #creaturedesign #monster #mucus #flu #fluseason #flushot #slime #slimyseries

821

28

Eucalyptus is basically the answer to everything right? 🌿🙌⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ We are heading into the flu season, and stuffy noses, sore throats and headaches are going to be all too frequent.⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Have you ever tried Eucalyptus in the shower?⠀⠀⠀⠀⠀⠀⠀⠀⠀ It's a great way to revive yourself in the morning and relieve congestion, soothe headaches and ease muscular pains.⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ If you can't get a hold of a bunch to hang in your shower, try our Eucalyptus Cubes.⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ All you need to do is place them in the corner of your shower and splash a little water on them and let the steam carry the vapors and breathe in their goodness 🥰🌿⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Visit zerowastecartel.com to purchase⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Image via the lovely @wandering_wild_home

4.90k

72

Can you tell I’m sneezing and coughing under this helmet? #fluseason . . . . . . . #cappuccinomoto #yamahaxsr #scrambler #motostyle #xsr700 #classicmoto #motonation #motorcycle #motophoto #caferacer #caferacersofinstagram #caferider #pipeburn #ridejohndoe #bomberjacket #agvhelmets #motoadventure #motorbiker #motogear #bikersofinstagram #motorcyclejacket #motorcycletrip

777

2

No flu here😄😄😄

648

27

Kissy kissy all day long with my bestie 😘✌🏼 Kissing during flu season? Call me crazy but I like to live dangerously 🤪 No need to worry about spreading germs and colds over here, with Ocillo from @boironcanda it can actually help to reduce the cold duration 🥳 But just in case we do get it, Stodal will help relieve our cough (they have a special one for kids too). . But let’s be honest I’d kiss him all day everyday anyway because it’s always worth the cold 🥰 Use code livinlifewells30 to save 30% . . . . . . . . . . . . . . . . #homeopathy #oscillococcinum #fluseason #oscillo #stodal #cough #coughsyrup #yvrmoms #yvrlife #momtogs #allthehearteyes #ohheymama #nestingly #letthekids #flashesofdelight #honestmotherhood #cameramama #mumsofinstagram #momlifeisthebestlife #targetfinds #targetstyle #targetmom #targetforthewin #target #targethome #targetdeals #targetlife #motherhood #clickinmoms #thehappynow

736

95

Recent feeds

Copious amounts of tea & coffee later and my sore throat is gone! 🍵☕ #fluseason #flu #cold #winter #Christmas #glasses #christiandior #buzzcut #weekend #girlswithbuzzcuts #girlswithshavedheads

2

0

The only one giving me attention #fluseason

17

0

When that little cold/flu couldn’t mess with you if it wanted to because you just ordered a cleanse from The Beet Box so your immune system is 💪🏾💪🏾💪🏾 . . . . . . . . #TheBeetBoxJuice #RedistributingHealth #ColdPressedJuice #CleanseMeBaby #HealthisWealth #GlenwoodHealthFoodBoutique #HealthForLess #UrbanCityMarket #BlackHealthMatters #RawJuiceCleanse #HealThyBody #HealthIsWealth #AffordableHealth #EatClean #TheBeetBox #BlackVeganSocial #FluSeason #EarthMedicine #HealthyMind #YourHealthMatters #HealthyHood #HerbalMedicine #SupportBOB #celeryjuice #ChangeTheWayWeEat #Changethewaywelive #PlantBasedBae #womenowned #blackowned #Okurrr via @preview.app

3

0

#fluseason

1

0

doesn't @plentyandwell make airloom look sooo good?! "I had dabbled with a few seasonal wellness supplements and literally nothing would help. I started taking Airloom and it WORKED. Like for real for real which felt like the biggest relief after so many failed attempts. I started noticing a decrease in my symptoms within about a week of taking it and the symptoms just started getting better and better!" check out the full review of airloom at http://bit.ly/plentyandwell

0

1

Today’s Reminder! Drink lots of water, wash your hands and cover your sneeze/cough to avoid spreading the Flu this season! Discoverytrials.com . . #drinkmorewater #drinkwater #healthylifestyle #health #healthtips #healthtipsoftheday #healthtip #information #funfacts #funfactsoftheday #saturdayvibes #saturday #weekendvibes #weekend #dctresearch #clinicalresearch #clinicalstudies #clinicaltrials #clinicaltrial #advancemedicine #research #medicalresearch #flu #fluseason #todaysreminder #reminder #reminderoftheday #dontforget #didyouknow #didyouknowfacts

0

2

0

As the days get colder and flu season lurks, do not forget to get your daily dose of LOCAL honey. Just one tablespoon a day (I love mine on top of Greek yogurt or oatmeal) contains massive amounts of antioxidants, lowers LDL (bad) cholesterol while raising HDL (good), lowers blood pressure, promotes burn and wound healing, and even suppresses coughs and excessive sneezing. Another gift from our friends the 🐝🐝🐝🐝

3

1

FLU SEASONS AROUND 😷 🤧 KEEP THOSE BATHROOM 🚽 & KITCHENS SANITIZED !!! #rayscleaningservices #flu #fluseason #sanitizer #sanitized #holidays #cleanup

0

True story! #sleekjamaica #irievibes #jamaicancanadian #patwa #goodmorning #fluseasonsucks #fluseason

1

0

Good morning to all the yoni steamers with that clean clean healthy thang . 🌸 @healthwealthimpact 💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫💫We created the best collection of herbs to give your yoni everything it needs to heal , detox and nourish itself. Yoni steaming is ancient practice that Significantly reduce pain, bloating and exhaustion associated with menstruation. Decrease menstrual flow as well as reduce dark purple or brown blood at the onset or end of menses. Regulate irregular or absent menstrual cycles. Increase fertility, especially when combined with ATMAT Speed healing and tone the reproductive system after birth. Reduce uterine fibroids, ovarian cysts, uterine weakness, uterine prolapse & endometriosis. Assist with the repair of a vaginal tear, episiotomy, or C-section scar. Assist with the healing of hemorrhoids. Relieve chronic vaginal/yeast infections, and works to maintain healthy odor. Ease symptoms of menopause including dryness or pain during intercourse. Detoxify the womb and remove toxins from the body. Release stored emotions and tap into the energy that is our creative potential. Lastly is in-depth detox from sexual trauma or past relationship to restore ph balance .💫 #yonisteam #bestyonisteamherbs #vaginalsteam #vsteam✨ #HealthWealthAndImpact #HealthIsWealth #alkaline #alkalinediet #alkalite #alkalinevegan #alkalinevegandaddy #alkalinelifestyle #drsebi #sebianlifestyle #alkalinefoods #biomineral #seamoss #burdock #vegan #africanbiomineralbalance #seamoss #seamossbenefits #seamossbenefits #fluseason #doyouseamoss #phbalance BEST YONI STEAM IN THE MARKET CHECK OUT CONTEXT . Exoctic herbs from the West Indies . @organicbodiesbyhwi @healthwealthimpact @erod_highlyfavored @mommieprenuer

9

0

Menthol Herbal Chest Rub is RESTOCKED! A natural alternative to Vick's Vapor Rub. . . . . #menthol #sinusclearing #sinusrelief #naturalremedies #wellness #health #bewell #herbalist #aromatherapist #flu #fluseason #stockingstuffer #eastbay #sunol #momentrepreneur #shopsmall #vegan #plantbased #herbalremedies #plantmedicine #medicinalherbs #witchywoman #naturalingredients

0

COLD OR FLU? . KNOW THE DIFFERENCE . The flu & cold can have similar symptoms. The difference is how intense they feel & how common they are. In general, symptoms of the flu appear quickly, while symptoms of a cold happen slowly. . Cold: - You may feel chills but fever is rare - Cough, chest discomfort (mild but may last a while) - Mild Body aches & pains - Tiredness (you can still do your daily activities) - Mild Headache - Sore throat - Stuffy, runny nose, sneezing . Flu: - Fever - Cough, chest discomfort (dry cough can be severe) - Body aches & pains (can be severe) - Bedridden (you may feel extremely exhausted) - Headache (can be severe) - Sore throat - Stuffy, runny nose . . #cold #flu #coldvsflu #fever #coldseason #fluseason #headache #cough #flusymptoms #coldsymptoms #chiropractor #kinesiology #kansas #kansascity #northkansascity

12

0

Spicy Ginger Carrot: Get Well Soup! Great for a wintery day and especially if you are feeling under the weather! Flu Season is upon us and we need to be ready! Thanks to @mtlveg, we discovered this home remedy that is also delicious! For the full recipe, go to mtlveg.com ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #fluseason #soupsaturday #mealprep #vegetarian #soupforthesoul #wellnesswknd #wellnessgetaway #wellness⠀⠀⠀⠀⠀⠀⠀⠀⠀ #sparetreat #yogaretreat #healthyfood #healthyliving

8

0

Protect yourself, your loved ones and others around you who maybe more susceptible to catching the Flu. . https://integritaswellness.com/blog/f/influenza-epidemic-2019 . #InfluenzaVaccine #FluShot #Flu #FluSeason

1

0

Elderberry Syrup Giveaway! Our family uses elderberry syrup instead of the flu shot to stay healthy! We're giving away a bottle of @sweetssyrup Sweet's Elderberry Syrup to **2** winners! It's easy to enter the giveaway: 1. Follow @deep_roots_at_home (if you don't already) 2. Comment on this post 3. Optional: tag friends in comments for additional entries, one per comment We'll pick 2 winners on December 16th! Rules: Giveaway ends on December 15th at 11:59pm. Open to U.S. residents only. Two winners will be chosen. By entering this contest, you release Instagram from any responsibility. This promotion is in no way sponsored, endorsed or administered by, or associated with, Instagram. . . . #deeprootsathome #healthyliving #healthylivingblog #livewell #sweepstakes #giveaway #sponsored #elderberry #elderberrysyrup #fluseason #stayhealthy #immunesystembooster Official contest rules: https://deeprootsathome.com/instagram-contest-rules/

15

29

Rosie is being a great nurse since I’m stuck on the couch with the flu. #sickday #fluseason #igottheflushot #rescuedog #rosielovesme

0

1

Sniffles? Shower steamers made with menthol crystals and eucalyptus to the rescue! #etsy #showersteamers #showerbombs #fluseason #christmagiftideas #selfcare #showerspa #spashower #handmade #bathandbody #coldandflu #coldandfluseason #feelbetter #stockingstuffers #stockingfillers

2

0

Yep. Anyone else suffering from the never ending chain of colds this season like us? 🖐️. This meme is so accurate... #momgineeringthefuture #pleasejustsleeponefullnight #fluseason #exhausted #tired #summercomeback #sciencemom

4

0

We had an overnight stay but today is a new day!!! Thank you for all the sweet messages. My feisty girl is on the mend! Thank you thank you to my people for taking care of my peeps. Love you all very much! Fluids saving the day! #fluseason #washyourhands #prayersformygirl #hopetogohome

35

5

My favorite hand sanitizer @babyganics #babyganics #babyganic #babyganicsbrasil #babyganicsnyc #cleankids #germfree #fluseason #youtubekidschannel #klaudiakidsshow #hilfiger #hilfigercollection #tommyhilfigerkids #hilfigerkids

6

0

It's the best way to prevent the flu which can be life threatening. Pop over to your local Day Lewis Pharmacy and get yours today! #DayLewisPharmacy #NotJustAPharmacy #flu #fluseason #sniffleseason #unwell #fluvaccine #returnoftheflubugs #sayboototheflu #fluvaccine #winterwellness #nhs

8

0

Master Tonic ready 🔥. . . . Garlic. Turmeric. Black pepper. Ginger. Cayenne. Onion. Lemon juice. Apple cider vinegar. Maple syrup. Cinnamon. Raw local honey. . . . $12/pint for local deliver or available at #drericsoffice. . . . #immunesupport #fluseason #naturesflushot #naturesremedy #antiinflammatory #guthealth #gutbrainconnection #foodasmedicine #foodheals #nutrition #health #wellness #dreric #mastertonic #santamonicahealingarts

2

0

We have shared information about the Flu 😷 over the past couple of months. The CDC is now reporting that the United States is seeing more flu than is typical for this time of year. Knowledge is Power, Empower yourself and Family don’t delay. Flu shots help to Prevent the Flu 😷 and are available in all of our offices. Call today to schedule an appointment: Waldwick: 201-445-1700 Wayne: (Parish Drive) 973-305-8300 Wayne: (Hamburg Turnpike) 973-389-1800 www.highmountainhealth.com #highmountainhealth #flu #fluseason #urgentcare #caringdoctors #nj #passaiccountynj #bergencountynj #familymedicine #njdoctor #waynenj #waldwicknj #waldwickmoms #waynenjmoms #totowanj #littlefallsnj #cliftonnj #franklinlakesnj #pomptonplainsnj #pomptonlakesnj #butlernjtattoo #westmilfordnj #riverdalenj #montclairnj #caldwellnj #fairfieldnj #hawthornenj #wyckoffnj

1

0

RD NATURALS will be at two great events on this beautiful December weekend. We are in the midst of flu season now so make sure you have your elderberry on hand to either be taking once daily for prevention and 4 times per day at the first sign of illness. Here are the details: SATURDAY 12/7 - Homegrown Holiday Bazaar 10am-4pm  2662 Mullet Hall Rd, Johns Island, SC 29455 SUNDAY 12/8 - Sunday Brunch Farmers Market 11-3pm 1977 Maybank Hwy, Charleston, SC 29412 (Behind the Pour House) Hope to see you there. Can't make it or live out of town? We ship to all 50 states (free shipping orders over $50). Please tag your family and friends to keep them healthy during this busy holiday season. Links in bio for ordering details. Also available on Amazon.

8

1

BEE&YOU Royal Jelly Bee Pollen Propolis Chewable Tablets support your immunity and promote energy! Its 100% natural formula only contains propolis, bee pollen carob, and cocoa. You may take two tablets daily, preferably between meals. . . Read more from www.apithecary.ca . . . . . . . . #beeandyoucanada #apithecary #winter #royaljelly #toronto #canada #torontomoms #seasonalallergies #fluseason #influenza #hightemperature #tiredness #weakness #noaddedsugar #glutenfree #palmoilfree #healthysnack #healthspread #honey #propolis #pollen #antivirus #immunitybooster #healthyfood #antibacterial #instagood #antiinflammatory #antioxidants #instamoment #instapic

4

0

Getting ready for breakfast. We had a rough night last night Fiona has a wicked cold😷🤒 #sickbaby #breakfast #momlife #fluseason

1

0

#essentialoilsaturday I’m ALL about the kiddo line from @doterra 🙌🏽 💜 Every morning before school, the kiddos get #stronger down their spine and back of neck to support their immune system and we always have an assortment around the house ( like in our everything drawer!) so they can grab #brave #thinker #rescuer #calmer or #steady when they need it! 💜 Link to my Doterra page in profile- Comment below or DM me to learn more! 💜 #essentialoils #holistichealth #proactivewellness #fluseason #winter #protection #plantsheal #doterra #hcydailydose #heartcenteredyou #investinyou

7

0

t’s that time of year, flu season is here! If you or a family member is experiencing flu symptoms (fever, cough, muscle or body aches, headaches, fatigue, sore throat, runny or stuffy nose) it is important to get treated as soon as possible. Medications for the flu work best when used within 2 days of getting sick. Antiviral medications used to treat the flu help to decrease the severity and duration of the flu. Don’t forget that hand washing is one of the best ways to prevent getting sick. If you are sick, cover your cough, and limit contact with other people to help decrease chances of spreading the flu to others. If you’re experiencing any of the mentioned symptoms, we have same day appointments available where we can test for the flu and begin treatment if necessary! Call (208)575-0978 or book online today at Kuna healthcare.com #kuna #kunaidaho #idahome #fluseason #fluseasonsucks #familymedicine #kunahealthcare

2

0

This past week was National Handwashing Awareness Week. As medical professionals, you know how important it is to have clean hands when it comes to preventing illness and disease. Heading into cold and flu season is a great time to remind kids (and adults!) about this vital personal hygiene routine. Head over to our Facebook page to find the link to an #AAD resource on hand (and body) washing to share on social media today! · · · #myDermRecruiter #NationalHandwashingAwarenessWeek #FluSeason #Dermatology #SkinCare #DermatologyProfessionals #DermatologyPractices #DermatologyProviders #AmericanAcademyOfDermatology #SkinCareForKids #HandWashing #StopTheSpreadOfDisease #DermatologyRecruiters #DermatologyCareers

2

0

Cold & flu season is going strong and I know a lot of you are trying to keep your family healthy. I shared some of these tips a couple months back but since I have been getting lots of questions again lately, I thought it would be a good reminder to share again!⁠ ⁠ These are 5 really important ways I keep my family healthy in the winter months:⁠ ⁠ ✔️We have essential oils in our diffuser (my favorite is @doTERRA On Guard)⁠ - check out my friend @jenbroyleshealthcoach to learn more⁠ ⁠ ✔️I also do a lot of nasal irrigation using Xlear Sinus Rinse - Xlear has xylitol and helps to decrease adherence of germs to the nasal mucosa. I also use Xcear nasal spray for Kids at the first sign of mucous (hydration is also important for thinning out mucous!)⁠ ⁠ ✔️Sleep is critical! I’m careful we all get to bed on time… and take an extra nap on the weekends if we can.⁠ ⁠ ✔️Frequent hand washing? You bet. I make @branchbasics foaming hand wash with doTERRA On Guard.⁠ ⁠ ✔️We limit sugar, especially when someone at home is sick - because sugar is no good at all for the immune system. Some people say cold and flu season hits because of all of the sugar during the holidays!⁠ ⁠ You can also read more about the natural remedies I use to prevent cold and flu in the blog post on my website called “Flu Season: 10 Natural Remedies You’ll Find In My Medicine Cabinet To Fight Influenza”: https://drchristinemaren.com/natural-remedies-to-fight-influenza/⁠ ⁠ Let me know the tried-and-tested ways you keep yourself healthy in the comments below! 👇🏼 #drchristinemaren #functionalmedicine⁠ .⁠ .⁠ .⁠ #coldandflu #naturalremedies #fluseason #autoimmunedisease #fatigue #tired #hypothyroid #hashimotos #adrenalfatigue #ibs #guthealth #guthealing #brainhealth #leakybrain #anxiety #leakygut #rootcause #inflammation #hormones #hormoneimbalance #sibo #candida #candidaovergrowth #microbiome #naturopathic #livenaturopathically #doctorsofinstagram⁠

10

2

Flu and cold season are upon us! Here are my best tips to help decrease your symptoms and potentially shorten the amount of days that you're sick! Read the transcript of this video and find out where to buy the products mentioned by clicking the link in my bio. https://www.dremilyparke.com/2019/11/27/functional-medicine-flu-treatments/ #fluseason #coldtreatments #naturalflutreamtns #alternativemedicine #fxmed #functonalfitness #functionalmedicine #holistichealth

3

0

It’s that time of year where the germs are active. Juicing helps you stay ahead of them. Your body needs the extra support during fall and winter season. You can get the minerals and vitamins you need on a daily basis from fresh fruits and vegetables by drinking fresh great tasting juice. Wash the vegetables really good. You can soak them in baking soda for 20 minutes to help clean debris and dirt off them. Rinse thoroughly. Recipe: 2 bags carrots 🥕 1 bag celery 1 nice size fresh ginger 2 cucumbers 🥒 Add slices of fresh pineapple 🍍 to sweeten and for more fiber. You can get the jars from Wal-mart. Enjoy!!! #freshjuice #fluseason #flushot #flushots #DrLA #SweetheartMitchells #sweetheartmitchellcollection #selflovecoach #selfcarecoach #wellnesscoach #couplescoaching #selflove #selfcare #whippedsheabutter #massagecandles #pamper #justrelax #setthemood #bathtime #herbsandsalts Click on link in bio

4

0

Sea Moss Soap Review🌱 I’ve assisted tons of clients with clearing up a variety of skin disorders. Eczema, psoriasis, dermatitis, roseacea, fungal infections, etc. You name it, we’ve tackled it. Although these issues are internal, when seeking topical relief, Sea Moss has always been in the mix. It’s ability to hydrate and nourish the skin while knocking out skin disorders is truly something. It also helps reduce the appearance of wrinkles and diminishes dark circles and bags under the eyes. This seaweed offers 92 of the 102 minerals of which our bodies are made. Loaded with nutrients and minerals (Amino acids, vitamins B12, B1 & B2, calcium , chromium, iron, magnesium & zinc). Improves thyroid health, strengthens the bones & eyes ,soothes mucus membranes, anti-inflammatory & anti-bacterial. Mind you, our skin absorbs EVERYTHING we put on it. Enjoy the benefits with each bath or shower 🧼 🌱 Grab a jar of gel for a nice face mask and you’ve got a killer skin routine on your hands💫 #alkaline #electric #govegan #plantbased #allnatural #organic #nongmo #holistic #floridagrown #immunity #fluseason #immunesystem #immunesupport #healthyimmune #healthiswealth #antiviral #antiparasitic #parasitecleansing #medicinal #plantbased #healingherbs #vegan #plantbased #smoothie #detox #nutrition #rawvegan #fruitarian #seamoss #wildcrafted #organic #raw #nongmo

12

3

☀️I've been sick with the flu all week and this is by far the sickest I have ever been. There is nothing worse than being stuck in bed feeling helpless, unmotivated, and uncreative. The only thing I accomplished was drinking copious amounts of juice and binge watching 40 episodes of Catfish. Here is a painting I did for @lostinfloat this summer because nothing sounds better than floating away from this flu bod I'm in right now. #fluseason #sick #paintings #abstractart #artoninstagram #canvasartwork #mixedmediaart #contemporaryart #acrylicpainting #flotationtherapy #lincolnnebraska #midwestartist

31

6

Raw Cold-Pressed Ginger-Lemon Wellness Shots now available at Green Vida. Ginger has some of the highest antioxidant levels of all fruits and vegetables. It is anti-inflammatory, regulates blood sugar and increases blood flow. Helps for quicker muscle recovery and helps prevents the cold and flu! This stuff is powerful 👊#gingershot #greenvida #organic #coldpressedjuice #juicebar #wellness #fluseason #greenvidaco #eastonpa

29

0

We’d like to announce our newest member to our RevIVed team, Erica Baar! Erica is from Rockford, MI and graduated from Hope College in Holland, MI. She has been a Registered Nurse for 4 years! Besides working with the best team, she likes to travel, drink wine and dance 😁 Say hi to her smiling face next time you’re in for a drip!

50

6

Look what’s boiling away over here!!! Fresh Elderberry Syrup. This batch is headed over to Hidden Horseshoe Produce, the next one is SOLD OUT and if I need to add another batch please message me with your orders. #fb_butter_cream_bliss_by_bina #elderberry #elderberrysyrup #foodiesofphiladelphia #philadelphiafoodie #chestersprings #westchester #glenmoore #exton #kop #westvincent #philadelphia #malvern #downingtown #organicelderberries #organiccinnamon #organiccloves #freshginger #localhoney #stayhealthy #stayhealthy2019 #coldandfluseason #healthyfamily #sickdays #vitamins #boostimmunity #boostimmunity #immunebooster #antioxidants #homeopathic #fluseason

4

0

When a nurse comes and says that I need to put on a mask because they don't have my flu paperwork, I am like girl get out of here!!!! Now girl I just told you that I took it at my full time job and we have it on our badge. Who would lie about getting a freaking flu shot? #annoyingpeople #flushot #healthcareprofessional #crna #crnalife #anesthesia #fluseason #nursingofinstagram #instanurse #lvn #lpn #ma #cna #endoscopycenter #sidejob #hustlejob

3

0

It's flu season, protect yourself . . . . . . . . #fluseason #publichealth #healthylifestyle #staysafe #flushot #doctorsorders

1

0

It's that time 😂 #maskup #fluseason

2

0

‘Tis the sneezin’!🤧 South Florida weather this time of year is paradise compared to some winter wonderlands out there. But alas; our annual cold front has left me with the flu and a case of the grumps. Soup to my sniffly rescue! ——————————————————————— •1 whole chicken (for this I used the remains of our carved citrus//apple stuffed chicken) •3 handfuls of fingerling potatoes (skin on for added Vitamin D) •Your choice of vegetables, (organic has less pesticides but frozen will also do just fine) *Crock Pot for 12 hours. **Add oils//seasoning as you like or prefer, I opted out for this soup as it’s for the health not really for the taste. ***Let cool, serve & store.

31

1

Being sick sucks. . Receiving a get well ecard is like chicken soup for the soul. . 👉 Link in bio.

3

1

I hear these misconceptions about the #flushot every day. As a pediatrician, immunologist, and parent - it is a no brainer for me to get the #fluvaccine every autumn. Influenza actually kills THOUSANDS of people, many previously healthy, every single year. Think about that - with all of our medical advances, almost 100,000 people still die each year. #Vaccines are one of the most effective medical accomplishments - we can introduce a small inactivated portion of a virus or bacteria and our immune systems then develop protective antibodies. If the real virus or bacteria is encountered, our immune systems are well equipped to recognize it and fight it off quickly. We may still get sick, but not nearly as sick if our immune systems didn’t have that practice. Unfortunately, influenza is REALLY good at changing some of it’s recognizable parts every year, which is why we need to get annual vaccines. Even then, they still may miss the exact strain that may infect a specific area. Still much better than not being vaccinated. Quick refresher: ✅Flu shot does NOT cause the flu or any infection. A normal immune response to the foreign antigen is mild fever, redness at injection site, and some achiness. Don’t worry - if you don’t have this afterwards, your immune system is still working just fine😉 ✅It takes about 2 weeks for our immune system to produce those protective antibodies, so we should get our flu shot early in the autumn...but it’s never too late! Protection lasts through flu season. ✅A cold or fever/vomiting is NOT the actual flu. Influenza makes people VERY sick with fever, fatigue, achiness lasting a week or so. Influenza takes you down for the count and you will miss work or school for a prolonged period. ✅Infants, young children, elderly and anyone with chronic lung or heart problems are at highest risk for severe complications from influenza. Hope this helps clarify some #facts about the flu. As always - ask any individual questions to your personal doctor who is best suited to understand your health and decisions surrounding your care. #fluseason #health #wellness #sick

31

5

Stressed and I'll is the greatest combination right now. #fluseason #merrystessmas

0

Don't let a cold our flu get you down this holiday. #beproactive #wellnessplan #vitaminsandminerals #herbs #homeopathics #supplementsthatwork #coldsandflu #fluseason #nutritionist #expertadvice #thedifferenceisknowledge #vitaminspecialists #healthfoodstore #wellbeing #health #healthyfood #natural #organic #vitaminrtakershealthylifemakers

5

0

Never underestimate the power that one good workout can have on your mind.”Kara Goucher it was HARD to get out this morning for a post-sinus infection long run; I feel so good for doing the workout as planned! But now, some more of this 🤧 anyone else got this bug🐛 ? . . . . . #qotd #runningmotivation #running #girlswhorun #instarunners #runnersofinstagram #runningmotivation #runningcommunity #corrida #fluseason #asthmatic #runningforgood #londonmarathon #2020londonmarathon #marathontraining #asthma #thisgirlcanrun #garminUk #ukrunchat #londonrunners #veganrunners #corridaderua #maratona #whyirunldn #asthmaticrunners

32

4

Vitamins!!! Get in my system and fix me!! #vitamins #health #glucosamine #iron #vitaminb #omega3 #codliveroil #boostthatimmunesystem #immunohealth #fluseason #healthylifestyle

0

#Questions #FoodForThought #SelfReflection #Instagram #InstaDaily #InstaGood #Flu #Shot #FluSeason #Sick

10

6

Get Our Elderberry Herbal Drops Available At 👉🏻 www.Daodrops.com 🔥 (Link In Our Bio). Our Elderberry Drops Provide Daily Immune Support & Protection Against Colds 🤧, Flus 🤒 & Viral Infections 😷.. ... DID YOU KNOW? Elderberries 🍇 are known as natures flu shot? Elderberries have been long touted as a herbal remedy for colds and flus, due to its potent antiviral effect. Elderberries are a rich source of antioxidants which reduce inflammation and strengthens the immune system allowing for significant relief of cold and flu symptoms within 48 hours.. • A 2004 study published in the Journal of International Medical Research, found that if an elderberry extract is used within 48 hours of the onset of the influenza A or B virus, the duration of flu symptoms is shortened by an average of four days.. • A 2009 study published in the Online Journal of Pharmacology, flu patients were given four daily doses of elderberry extract, which led to significant improvement of symptoms in 24 hours. Within 24 hours, the muscle pain, headaches, fever and nasal congestion of patients were greatly reduced. According to researchers nearly 90% of the elderberry extract treated patients were either symptom free or had only mild symptoms within 48 hours.. • Sources:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4848651/ ... ... ... #detoxjuice #elderberry #holistichealth #holistichealing #fruitarian #naturalhealing #juicing #naturalremedies #greenjuice #veganforhealth #healthandwellness #wholefoodsplantbased #healthiswealth #foodismedicine #wholefoods #fluseason #alkalinevegan #alkalinediet #elderberrysyrup #alkaline #rawvegan #rawfood #plantbased #plantbaseddiet #fruits #detoxify #holisticnutrition #superfoods #healthyfoods #detoxify

68

1

From omega 3 packed oily fish through to nuts and seeds. Discover some brain supporting foods - link in bio. #betterlife 💚❄️ _____________________________________________________________ #performance #fitness #recovery #nutritiontips #sleephealth #lifetips #sleephygiene #wellness #exercise #summer #septemberblues #autumn #dreams #fluseason #sleep #hotdrinks #brainhealth

9

0

Just went outside for the 1st time in 2 days and this was my reward for grabbing the mail. Beautiful Saturday. #AnnKellyWDUV #AnnVentures #Sunrise #sunriselover #fluseason #fluffyrobe #SaturdayMorning #quarantine #bingewatching #sleepisanoption #goodmorning

14

1

Protect yourself and those around you. It’s not too late to vaccinate! * * *#ece #childcare #childcareprovider #daycare #children #preschool #learning #virginia #quality #safety #infants #toddlers #schoolage #childcare4all #children #professionaldevelopment #earlychildhood #earlychildhoodeducation #training #qualitychildcare #qualitymatters #business #businesspractices #education #prek #flu #fluseason #washyourhands #healthy

2

0

Dear Friends: I am extremely sorry to inform you that due to illness we must announce our cancellation at today's Pop-Up at What's In Store in Cobourg. We sincerely apologize for any inconvenience this may cause. Please accept our sincere apologies. Thank you for understanding, Lots of Love, Angela & The Barking Dog Gang . . P.S. Don't worry folks, tomorrow's Christmas Night Market is a go! If I'm still too sick to work my awesomely supportive Dude has agreed to work the show for me. #ilovemyboyfriend

10

5

My spirit animal on point as always 😂 #sicknote #dying #fluseason #eyeore #eeyorequotes

8

0

Have to grate in the fresh ginger and get my syrup boiling this morning! You will find 8oz bottles at Hidden Horseshoe Produce in Glenmoore. 821 Little Conestoga. #fb_butter_cream_bliss_by_bina #elderberry #elderberrysyrup #foodiesofphiladelphia #philadelphiafoodie #chestersprings #westchester #glenmoore #exton #kop #westvincent #philadelphia #malvern #downingtown #organicelderberries #organiccinnamon #organiccloves #freshginger #localhoney #stayhealthy #stayhealthy2019 #coldandfluseason #healthyfamily #sickdays #vitamins #boostimmunity #boostimmunity #immunebooster #antioxidants #homeopathic #fluseason

2

0

🎄 #jinglebells #merrychristmas #peaceandlove #reasonfortheseason #fluseason #pharmacy #familyowned #barbadosbusiness

0

TIP #5.💧 Water: Since our body’s fluid needs increase when we’re fighting infection, drinking an extra two cups of water plus your daily minimum can fuel regeneration of immune-fighting lymphatic cells to get your body feeling stronger.💪🏻💧 #winter #healthy #tips #water #stayhydrated #cold #fluseason #prevention #health

8

0

Don’t. Just don’t. Not only is it hazardous to yourself, you risk spreading the sickness to your friends and fellow gym patrons. You might think you’re “hardcore” for your “dedication” but you’re really just being inconsiderate. Your body is telling you it needs rest, so give it what it wants. In the marathon of powerlifting, what’s one workout among thousands? Thank you for tuning in for my little PSA. Stay safe this holiday season! #OMSA #Powerlifting #fitness #gym #health #strengthtraining #athlete #training #strong #fit #competition #lift #instafit #coaching #barefoot #coach #sick #sickness #fever #PSA #fluseason #flu #wellness

36

2

Too busy for the flu jab? At Whitworth you don’t need an appointment for flu jabs. Simply visit or phone your nearest Whitworth to find out more. #Flu #FluSeason #Wellness #Pharmacy #HelpUsHelpYou #Vaccines

0

Morning 💗 Currently In Bed Dying My Throat Is Sooo Swollen 😭 Does Anyone Have Any Home Remedies For Tonsillitis? . . . . . . . . . . . #morning #pinkquotes #weekend #winter #inbed #chillvibes #fluseason #mumsofinstagram #momsofinstagram #homeremedies #mumlife #momlife #discoverunder5k #discoverunder1k #discoverunder2k #discoverunder10k #netflixandchill #uk

23

0

#Fail. Attempt to get #sickboy to drink fluids & take in #vitC whilst having no appetite to eat. It’s called #BoltFromTheBlue from @innocent, tastes like you’d think! #influenza #fluseason

4

0

As winter is upon us, and the flu is rampant, monitoring immune health is important. For any individual who is physically active and trains over four times a week, let alone striving for performance, immune health is something that should not be overlooked. There is a lot of evidence that demonstrates how strenuous exercise, if not managed well through rest, recovery and nutrition can depress the immune system, hindering performance outcomes. For this reason, the average baseline for immunity does not suffice and more attention is required by runners and particularly ultra runners in maintaining a healthy system. Vitamins Keeping up with vitamin supplements such as Iron, B12, and Vitamin D in the blood is important to understand how the immune system is functioning, especially during high volume and/or intensity training blocks. Nutrition While healthy eating guidelines around consuming an increase volume of foods high in antioxidants are important, it also pays to focus your attention on all food groups. Hydration Hydration should not be ignored as it encourages the production of saliva, the body’s first line of defense.This can be a challenge in the winter when many runners find it more difficult to drink. Herbal tea, no added sugar squashes and flavoured waters can all encourage the consumption of fluid to maintain hydration around and during training sessions; post exercise milk based recovery drinks can encourage rehydration as well as glycogen restoration and muscle repair. Carbohydrate Ensuring sufficient amounts throughout the day, particularly in high intensity or volume training blocks encourages appropriate fuelling and recovery for the body, preventing, the suppression inside, especially during the winter months and in the lead up to major races. Sleep In order to optimise immune health and recovery in active individuals, it is important to obtain sufficient sleep each night, ideally around 8 hours. 📸@itsdavo #race #run #flu #athlete #immune #immunesystem # #cold #health #sick #vitaminc #zinc #natural #echinacea #cough #organic #medicine #wellness #immunity #healthy #winter #sickday #physician #fluseason #season #doctor #healthylife

184

12

sicker than hell🤒 but decided to make myself feel better with a lil makeup and a lotta music😬💘 just cuz i feel like garbage, doesn’t mean i gotta look and sound the part too😁😎 being a semi normal human did take the whole ass life outta me today tho😴😴😷🤕😵💀 #fluseason #sucksballs #dead #cantbreathebutcanstillsing ?#sickbitches #arehellasick #walkingdead #neednyquil #sendhelp #dasbooboo

3

0

One picture that sums up my week... 🤧 __ #fluseason #howlongforsummer

7

4

Citrus for sickness. #fluseason #lemon #limes #london

5

0

. F.L.O.O.M. . Immune Bomb Roller Bottle Blend 👵 Grown Ups: In a 10ml roller bottle, add: Frankincense💧x 5 Lemon 💧x 10 Oregano 💧x 5 OnGuard 💧x 10 Melaleuca 💧x 10 🥥 Top up with fractionated coconut oil . . 👦 Kids: In a 10ml roller bottle add: Frankincense droplet 💧x 1 Lemon 💧x 2 Oregano 💧x 1 OnGuard 💧x 2 Melaleuca 💧x 2 🥥 Top up with fractionated coconut oil . . . #naturalwellbeing4u #naturalwellbeing #essentialoils #toxinfreeliving #toxinfree #immunityboost #immunesupport #immunitybooster #holistichealth #holistichealing #fluseason

15

1

BLACK SEED • The Remedy For Everything. Nigella sativa (known as black seed or black cumin) seed oil kills up to 89% of human LUNG #CANCER cells. Nigella sativa is a powerful herb used for thousands of years in traditional Chinese, Ayurvedic, Unani & Arabic medicine. Its potent ANTI-INFLAMMATORY & antioxidant properties, & has been used to suppress coughs, treat KIDNEY STONES, diarrhea & stomach pain. Black seed taken daily can decrease insulin resistance helping type 2 #DIABETES. Thymoquinone, one of the main active constituents within Nigella sativa, is superior to the drug fluticasone for #ASTHMA & can protect brain tissue from #RADIATION-induced nitrosative stress. Shop www.soapsandbutters.com #blackseedoil #etsy #etsyshop #fluseason #fluseasonsucks #naturalproducts

#fluseason feeds

Top feeds

11 hours ago

1.83k

45

2 weeks ago

39.57k

1.17k

1 day ago

739

10

2 days ago

561

58

1 day ago

821

28

1 week ago

4.90k

72

3 days ago

777

2

1 day ago

648

27

1 day ago

736

95

Recent feeds

8 minutes ago

2

0

14 minutes ago

17

0

14 minutes ago

3

0

15 minutes ago

1

0

23 minutes ago

0

1

23 minutes ago

0

0

30 minutes ago

2

0

33 minutes ago

3

1

34 minutes ago

0

0

37 minutes ago

1

0

42 minutes ago

9

0

47 minutes ago

0

0

55 minutes ago

12

0

59 minutes ago

8

0

59 minutes ago

1

0

1 hour ago

15

29

1 hour ago

0